Protein Info for Echvi_0832 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF16266: DUF4919" amino acids 22 to 213 (192 residues), 272.8 bits, see alignment E=9e-86

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWU0 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Echvi_0832 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MFLWAQGCWAQYWDFEQPDYSKIEGAVKNRASEMYYPKLLERFQQADATLGLSELRHLYY
GFVFHPDYKADKSAQVKDSLEVILQKETHSEEDLKQIVSFSEKILDKYPFEINTMNYQLY
ALEHLGDTTAYKEVSFQMEMIFETMLSSGDGASKASAFYVIDPAHELILMEALGLRSEDN
PQAMGKYDFLELAANDIGLEGLYFDLSPYRNIILHSLSNHNL