Protein Info for Echvi_0806 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: seryl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF02403: Seryl_tRNA_N" amino acids 1 to 112 (112 residues), 90.9 bits, see alignment E=6.2e-30 TIGR00414: serine--tRNA ligase" amino acids 1 to 418 (418 residues), 451.9 bits, see alignment E=1.2e-139 PF00587: tRNA-synt_2b" amino acids 226 to 402 (177 residues), 133.2 bits, see alignment E=1.1e-42

Best Hits

Swiss-Prot: 52% identical to SYS_SALRD: Serine--tRNA ligase (serS) from Salinibacter ruber (strain DSM 13855 / M31)

KEGG orthology group: K01875, seryl-tRNA synthetase [EC: 6.1.1.11] (inferred from 69% identity to mtt:Ftrac_2789)

Predicted SEED Role

"Seryl-tRNA synthetase (EC 6.1.1.11)" in subsystem Glycine and Serine Utilization (EC 6.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWG1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Echvi_0806 seryl-tRNA synthetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLQVNFIRENFDQAVEGLQKRFFAEPAEKLQKVLDLDKERKETQLQRDQLQAESNSISKK
IGLLMREGKKEEAETVKNRTAEIKGQIKSLEEKYSEIEEALKQLLYAIPNVPHESVKAGK
SADDNEVVLEHGEAPTLHEGKLAHWDLIKKYDIIDFELGNKITGAGFPIYKGKGARLQRA
LVNFFLDEATNSGYQEVQPPILINEESGYGTGQLPDKEGQMYHVTNDDLFLIPTAEVPVT
NMYRDVMLKAADLPIKNTAFTPCFRREAGSWGAHVRGLNRLHQFDKVELVQITHPDKSYE
TLEDMSTYVQKLLQKLGLPYRVLRLCGGDTGFTSALTYDMEVYSAAQEMWLEVSSVSNFE
TYQANRLKLRFKDEQKKTVLAHTLNGSALALPRIVAAILENYQTEKGIKMPEVLVPYLGF
EWIDEA