Protein Info for Echvi_0804 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type transport system involved in cytochrome c biogenesis, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details PF03379: CcmB" amino acids 6 to 211 (206 residues), 64.4 bits, see alignment E=5.2e-22

Best Hits

KEGG orthology group: K02194, heme exporter protein B (inferred from 61% identity to sli:Slin_1448)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT56 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Echvi_0804 ABC-type transport system involved in cytochrome c biogenesis, permease component (Echinicola vietnamensis KMM 6221, DSM 17526)
MWKEIIVLIRKEITLEWRQKYALNGILLYVVSAVFITYLSVGAKQGTIAVPTWNALYWII
ILFSAVNAVAKSFVQEHQGRQLYYYMTASPEGIIISKIIYNTLLTAVLALLGYVVFSVIL
GNPVQDQGLFVLNLLLGSIGFSACLTMVSGIASKASNNATLMAILSFPIIIPILLMAIRI
SKNAIDGLDRGVSVDKLLTLLAINAIIGTTAYILFPYLWRS