Protein Info for Echvi_0803 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type transport system involved in cytochrome c biogenesis, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 11 to 157 (147 residues), 55.9 bits, see alignment E=2.5e-19

Best Hits

KEGG orthology group: K02195, heme exporter protein C (inferred from 71% identity to mtt:Ftrac_2486)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVP2 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Echvi_0803 ABC-type transport system involved in cytochrome c biogenesis, permease component (Echinicola vietnamensis KMM 6221, DSM 17526)
MRANWWKVLAVILLAYTIIAGLLFEAPRLPILNETIRALHFHVTMWFGMIIMLVVAVVYS
VKYLRSGNLRDDDIAIEFTNAAILFGVLGIVTGMLWAKFTWGDYWSGDPKQNAAAIGLLI
YFAYLILRNSLVDVHQRARIGAVYNIFAFAAFIPLIFVLPRLTDSLHPGNGGNPGFNAYD
LDSKLRMVFYPAIIAWTLLGVWLASLRIRAKRLERILEDKLINQ