Protein Info for Echvi_0785 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fatty acid desaturase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF03405: FA_desaturase_2" amino acids 14 to 322 (309 residues), 416.5 bits, see alignment E=3e-129

Best Hits

Swiss-Prot: 50% identical to STAD_BRANA: Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Brassica napus

KEGG orthology group: K03921, acyl-[acyl-carrier-protein] desaturase [EC: 1.14.19.2] (inferred from 68% identity to hhy:Halhy_6519)

MetaCyc: 46% identical to acyl-[acp] 4-desaturase (Coriandrum sativum)
RXN-8390 [EC: 1.14.19.11]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.11 or 1.14.19.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Echvi_0785 Fatty acid desaturase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MKGTETINYELEKNLEVTNQLDKMVGETVDSVLVNPDECWQPTDFLPDMSEPDAFDEVRK
LQERAAEIPDTVITSLIGNMITEEALPSYQTYFNLLEGINPEGSLLSDRGWVRWSKAWTA
EENRHGDLLNKYLYLSGRADMKAVEQTIHRLIYNGFDPKSEKDPYQAIIYTSFQERATKV
SHVNTGKLADKAGDISLSRICKTIAGDEARHEKAYKSFMSRIFEIDPNGAVLAFEKMMRK
QIVMPAVLMGKGGNNPTLFDQFSAITQKIGVYTGWDYARIIDHLVKLWRIEHLTGLEGRA
AKAQEYLSGLADRYMRLADRLKTPDEISLAWLK