Protein Info for Echvi_0782 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized membrane protein (homolog of Drosophila rhomboid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 74 to 74 (1 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details PF08551: DUF1751" amino acids 65 to 157 (93 residues), 25.2 bits, see alignment E=3.1e-09 PF01694: Rhomboid" amino acids 69 to 217 (149 residues), 84.6 bits, see alignment E=1.2e-27 PF20216: DUF6576" amino acids 263 to 306 (44 residues), 45.5 bits, see alignment 1e-15

Best Hits

KEGG orthology group: None (inferred from 45% identity to dfe:Dfer_3809)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUU0 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Echvi_0782 Uncharacterized membrane protein (homolog of Drosophila rhomboid) (Echinicola vietnamensis KMM 6221, DSM 17526)
MYGGFWYYLKNAFNHKDNSLYKLLAINLLVFLVFLVLRVFLTISGEGALYQQLLSYFMMP
AEVSRIITQPWSIFTYMFMHEGIFHILFNMLFLYWFGLLVQEYLGSRKLANLYILGGLAG
AVLYVIMYNVAPYFIEQRDAALMLGASAGVYAIVVGAATLTPDTTFHLLLLGPVKIKYIA
IFYVVIAFANSTGANAGGELAHLGGAAIGYLYITMLRKGTDLGTPVQAVGRFFENVFAGR
PNVKVTYRKKNPPYKSEPLRETDTKTSKKEGTTQEEIDKILDKIADKGYDSLSKEEKRKL
FEYSNK