Protein Info for Echvi_0776 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 66 to 203 (138 residues), 73.6 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 51% identity to sli:Slin_3482)

Predicted SEED Role

"putative fatty acid hydroxylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWD7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Echvi_0776 Sterol desaturase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKIGRLERPDNNGSAQMFQNPVLEKMSRTHISIPIVMFLVIGGVSLFYALTTTTISIGI
GLLVTIVGLLVFTLVEYLMHKYFFHMVPDTPMKDKLQYSVHGVHHDYPKDKDRLAMPPFI
SGLYACIFYFVFTFLMGDYALYFLPGFLMGYALYLGVHYIVHAFQPPKNALKILWVNHAI
HHYKDPDVAFGVSSPLWDVILGTMPKKDK