Protein Info for Echvi_0770 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 31 to 489 (459 residues), 590.9 bits, see alignment E=7.9e-182 PF07992: Pyr_redox_2" amino acids 31 to 355 (325 residues), 255.7 bits, see alignment E=2.8e-79 PF00890: FAD_binding_2" amino acids 32 to 68 (37 residues), 27.2 bits, see alignment 1e-09 PF01134: GIDA" amino acids 32 to 173 (142 residues), 22.8 bits, see alignment E=2e-08 PF12831: FAD_oxidored" amino acids 32 to 73 (42 residues), 36.4 bits, see alignment 1.8e-12 PF13738: Pyr_redox_3" amino acids 34 to 339 (306 residues), 39.9 bits, see alignment E=1.4e-13 PF13450: NAD_binding_8" amino acids 35 to 96 (62 residues), 22.9 bits, see alignment E=3.8e-08 PF13434: Lys_Orn_oxgnase" amino acids 124 to 229 (106 residues), 24.5 bits, see alignment E=6.6e-09 PF00070: Pyr_redox" amino acids 203 to 280 (78 residues), 76.9 bits, see alignment E=6.3e-25 PF02852: Pyr_redox_dim" amino acids 374 to 482 (109 residues), 136.6 bits, see alignment E=1.8e-43

Best Hits

Swiss-Prot: 52% identical to DLDH1_ARATH: Dihydrolipoyl dehydrogenase 1, mitochondrial (LPD1) from Arabidopsis thaliana

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 77% identity to chu:CHU_3360)

MetaCyc: 52% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWP1 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Echvi_0770 dihydrolipoamide dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDLSGALKNNTFFVLGTLYLVLCSKPTNMTYDLIVIGSGPGGYVAAIRGAQLGMKTAIVE
KYPTLGGTCLNVGCIPSKALLDSSEHYHNAAHTFKTHGIDLKDLKVNLKQMISRKDDVVK
QNVDGISYLMKKNKIDVHQGVGSFVDKNTVKVTKDDGKSTEITGENIIIATGSKPASLPF
IEIDKKRVITSTEALKMKEVPKRMIVIGGGVIGMELGSVYARMGAKVSVVEFMDSLIPSM
DKTMGKELQKSLKKLGFEFYLKHKVTAVKSTAKEVTVTAENSKGEEVQVKGDYVLVSIGR
KPYTEGLNPEAAGVKVNDRGQVEVDEHLKTSADNIYAIGDVVKGAMLAHKAEEEGVLVAE
QLAGQKPHINYNLIPGVVYTWPEVAAVGYSEEQLKEKGIKYKTGKFPFMASGRARASMDT
DGLVKVLADAETDEILGVHMIGPRTADMIAEAVVAMEYRASAEDIARMSHAHPTYTEAFK
EACLAATENRALHV