Protein Info for Echvi_0768 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: carbamoyl-phosphate synthase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01369: carbamoyl-phosphate synthase, large subunit
  • amino acids 2 to 926 (925 residues), 1298.7 bits, E=0
• PF25596: CPSase_L_D1
  • amino acids 7 to 125 (119 residues), 138.2 bits, E=6e-44
  • amino acids 557 to 668 (112 residues), 156.8 bits, E=1e-49
• PF02786: CPSase_L_D2
  • amino acids 130 to 335 (206 residues), 213.3 bits, E=1.5e-66
  • amino acids 672 to 870 (199 residues), 94.8 bits, E=2.8e-30
• PF02787: CPSase_L_D3
  • amino acids 425 to 503 (79 residues), 87.5 bits, E=2.4e-28
• PF02655: ATP-grasp_3
  • amino acids 671 to 844 (174 residues), 29.9 bits, E=2.8e-10
• PF01071: GARS_A
  • amino acids 678 to 779 (102 residues), 28.4 bits, E=7.2e-10
• PF02222: ATP-grasp
  • amino acids 679 to 844 (166 residues), 35.1 bits, E=5.3e-12
• PF07478: Dala_Dala_lig_C
  • amino acids 680 to 842 (163 residues), 29.6 bits, E=2.5e-10

Best Hits

KEGG orthology group: K01955, carbamoyl-phosphate synthase large subunit [EC: 6.3.5.5] (inferred from 82% identity to mtt:Ftrac_1723)

Predicted SEED Role

"Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See L0FVL2 at UniProt or InterPro

Protein Sequence (939 amino acids)

>Echvi_0768 carbamoyl-phosphate synthase, large subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKDNSIKHVLIIGSGPIVIGQACEFDYSGSQAARSLREEGITVTLINSNPATIMTDPVT
ADNVYLLPLEKKSLVKILEEHPDIDCVLPTMGGQTALNLAIEADKAGIWDRFKVRMIGVD
IDAIETAENREKFKALLEELNVGVCIGKTATSFLQGKEIAQEIGFPLVIRPSYTLGGTGG
GFVEKEEEFENALMSGLKASPTHEVLIEQSILGWKEYELEVLRDSLGNMVVICSIENFDP
MGVHTGDSITVAPAMTLPDTVYQEMRNLAIKMMNGIGNFAGGCNVQFSVSPDNQTIIGIE
INPRVSRSSALASKATGYPIAKVAAKLAIGYNLDELKNSITGSTSAFFEPAIDYVIVKIP
RWNFDKFKGSDRRLGLSMKAVGEVMGIGGNFQEALQKACQSLEIKRNGLGADGKELKNQE
QILYSLEHPSWNRLFHIYDAFKLGISFRTIHDLTKIDKWFLKQIEELVHLDITLDKYTLD
TIPKDLMMLAKHKGYADRQIAHLLGCLESEVFNKRRDEMGIKRVYKLVDTCAAEFEAQTP
YYYSSFGEENESQVSDRKKVIVLGSGPNRVGQGIEFDYSCVHGVLAAKECGYETIMINCN
PETVSTDFDIADKLYFEPVFWEHIYEIILHEKPEGVIVQLGGQTALKLAEKLEKYGIKIL
GTSFEALDLAEDRGEFSSLLKENDVPYPEFGTIHSTDEALELCKTIGFPLLVRPSYVLGG
QGMKIVINEKELEQHVVEVLKDIPDNEILLDHFLEGAIEAEADAICDGENVYIIGIMQHI
EPAGIHSGDSYAVLPPYNLGDLVVRQIETFTEKIALALKTKGLINIQFAVKDDKVYVIEA
NPRASRTVPFICKAYKEPYVNYAVKVMLGENKVTDFEFKPYKKGYAIKEPVFSFHKFPNV
NKELGPEMKSTGEAIYFIDDLMDDYFLKIYSERNLYLSR