Protein Info for Echvi_0763 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: acetyl-CoA carboxylase, carboxyl transferase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit" amino acids 1 to 278 (278 residues), 355.5 bits, see alignment E=1.1e-110 PF01039: Carboxyl_trans" amino acids 91 to 241 (151 residues), 73.3 bits, see alignment E=8.1e-25

Best Hits

Swiss-Prot: 72% identical to ACCD_PEDHD: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 80% identity to mtt:Ftrac_1693)

MetaCyc: 47% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVK7 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Echvi_0763 acetyl-CoA carboxylase, carboxyl transferase, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MAWFKRKDAGIKTSTKEKKDTPDGLWFKTPKGNIIHTRELKSNAYVCPDDDYHVKIGSKE
YFEILFDGNEFQELDENMISGDPLDFVDSKPYTSRIEATINKTGLKDAVRTAVGKLDGQD
LVVACMDFGFIGGSMGSVVGEKIARAIDHSLKNNIPFLMISKSGGARMMEAGFSLMQMAK
TSAKLALLAEAKIPYISMLTDPTTGGVTASYAMLGDFNIAEPGALIGFAGPRVIRETIGK
DLPKGFQSAEFVLEHGFLDFIVDRRQLKSRLSTLLRLLKK