Protein Info for Echvi_0747 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Superfamily II DNA and RNA helicases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00270: DEAD" amino acids 30 to 196 (167 residues), 159.8 bits, see alignment E=8e-51 PF04851: ResIII" amino acids 49 to 191 (143 residues), 25.6 bits, see alignment E=1.6e-09 PF00271: Helicase_C" amino acids 233 to 341 (109 residues), 102.1 bits, see alignment E=3.1e-33

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 67% identity to dfe:Dfer_4097)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVJ6 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Echvi_0747 Superfamily II DNA and RNA helicases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDSPQSFENFKLNKQLLEAVKEAGYTKPTPIQEKTIPLALAGQDILGIAQTGTGKTAAY
VLPLLMKTKYAQGEHARALILAPTRELVIQIEQAILTLGKYTDLRYACLYGGVGPTPQIE
KIRAGVDIIIATPGRFMDIYSKGELFVRNIKTMVMDEADKMMDMGFMPQIRSILEVIPVK
RQNMLFSATFSERVERISHEFLEFPERIEIALQATTADTVAQTKYFVPNLKTKITLLDHL
LQNEEINRVIVFTKSRKNAEAVYQYLERRKHGEIRVIHANKGQNTRINSVDDFKSGDVRI
LVATDVAARGLDISMVSHVVNFDVPLIYEDYVHRVGRTGRAEQEGAAFTFVNPAEEYHFG
RIEEIIRMEVPEEPIPKEVRIADTPFAEKQAYDREIDKQRQKADPTFKGAFHEKKVRANT
NPHYNPEKKKVRGNKNSKAKRNRNQMKKKGGKR