Protein Info for Echvi_0733 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13432: TPR_16" amino acids 29 to 81 (53 residues), 26.9 bits, see alignment 1.9e-09 PF07676: PD40" amino acids 219 to 236 (18 residues), 13.9 bits, see alignment (E = 1.6e-05) amino acids 275 to 304 (30 residues), 25.6 bits, see alignment (E = 3.3e-09) amino acids 321 to 357 (37 residues), 15.7 bits, see alignment 4.2e-06 PF00691: OmpA" amino acids 533 to 628 (96 residues), 71 bits, see alignment E=3.4e-23

Best Hits

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSZ5 at UniProt or InterPro

Protein Sequence (640 amino acids)

>Echvi_0733 Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MMKNCFLSVLFIFLFLVGCTSLQQKGEKQFAAGEYQMAIGTFSKVLADNPDDSDANYYVA
ESYRLSNRIEAALPYYDKLLEEEGSFENYMKKAKSLRDQGEYEAAAAAYAQAKEHTSSDS
LLALAEWGEENMAQIQSITDYWPYHELQNYELLNTSGIDYAPVVSENFLYFTSSRRASGV
YPATGQGYTKLFRTRANGVKVDVQNVQALPEFRNEENLNQGAIAISPDGNTIIYARGNSL
SKKDLPEVNLFISYFRGAGFTDPIWMPVNEDQTYWNSTPAFSLDGETLYFASNRPGGYGG
IDLYKATKMANGDFGDPQNLGSAINTPGNEMFPRPMGEQLYFASDGHPGFGKLDLFVAEA
KDGQTTVTNLGKNINSVSDDFGIFFTNFPKEGFLSSNREGGVGDDDIYYFQDNTPKPKVV
NVFLNVKTLQNTVEGESVLPNARVALYDSTKQTVGGDFSNEQGRLRFQLEPNADFTLIAS
KNGYFTKSVPYSTIGKTPAQEDLIQDVTNITLDTTIVLDQLELEKAIVLENIYYDLDKAD
IRPDAAVELDKLVKILQDNPEIRIELSSHTDSRASDEYNRDLSQRRAQSAVDYIISQGIA
KDRLVAKGYGEDQPVIENAQTEEEHQRNRRTEFKVIEIEE