Protein Info for Echvi_0713 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01118: Semialdhyde_dh
  • amino acids 2 to 115 (114 residues), 112.7 bits, E=1.5e-36
• TIGR01296: aspartate-semialdehyde dehydrogenase
  • amino acids 3 to 325 (323 residues), 435.7 bits, E=5.8e-135
• PF02774: Semialdhyde_dhC
  • amino acids 136 to 310 (175 residues), 166 bits, E=1.1e-52

Best Hits

Swiss-Prot: 59% identical to DHAS_AQUAE: Aspartate-semialdehyde dehydrogenase (asd) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 74% identity to mtt:Ftrac_2138)

MetaCyc: 49% identical to aspartate semialdehyde dehydrogenase subunit (Bacillus subtilis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• aspartate superpathway (20/25 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

See L0FWF6 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Echvi_0713 aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLAVVGATGLVGSEILEVLAEHNFPFDELLLVASERSAGKKIAFKDKEYTVIGLAQAVS
EKPDIAIFSAGGDTSKEWAPKFAEAGTIVVDNSSAWRMDPTKKLVVPEINAKSLKIDDRI
IANPNCSTIQMVLALTKLRDRYGIKRVVVSTYQSVTGSGLKAVNQLQDERAGKEGEKAYP
HKIDLNVLPHIDVFQDNGYTKEEMKMINETKKIFEDPSIQVTATTVRIPVMGGHSESVNV
EFKEDFDLEEVKELLAATPGVVVEDDVANNVYPMPMNAHKKDEVFVGRLRRDESQPNTLN
MWIVADNLRKGAATNAVQIAEYLVEHSLV