Protein Info for Echvi_0709 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 999 TIGR00487: translation initiation factor IF-2" amino acids 418 to 998 (581 residues), 806.7 bits, see alignment E=1.4e-246 PF04760: IF2_N" amino acids 423 to 474 (52 residues), 48.8 bits, see alignment 1.7e-16 PF00009: GTP_EFTU" amino acids 501 to 659 (159 residues), 110.7 bits, see alignment E=2.4e-35 TIGR00231: small GTP-binding protein domain" amino acids 502 to 658 (157 residues), 107 bits, see alignment E=8.6e-35 PF01926: MMR_HSR1" amino acids 503 to 609 (107 residues), 39 bits, see alignment E=2.7e-13 PF00071: Ras" amino acids 504 to 660 (157 residues), 24.9 bits, see alignment E=4.9e-09 PF22042: EF-G_D2" amino acids 674 to 752 (79 residues), 90.6 bits, see alignment E=2e-29 PF11987: IF-2" amino acids 774 to 889 (116 residues), 140.2 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 66% identity to mtt:Ftrac_2449)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW50 at UniProt or InterPro

Protein Sequence (999 amino acids)

>Echvi_0709 translation initiation factor IF-2 (Echinicola vietnamensis KMM 6221, DSM 17526)
MSEEKMMRLGQVARKLNVGISTIVESMAKKGFDVESNPNSKISQEQFSMLAKEFKSSAQD
KEEASHLSIGKRHNETFTIKAESESVPEEAKKEEPAQPAPKQEEAPKKAPEKEDKVTSEA
EKLPGIKVLGKIDLSDKKQDKKEAPQKEEPKQKEAAPKQEEKKPVQEEAPKAAKPAEKAP
EKAVEKPKDESPKAEKSEQKENAKPSTPEAGKPQESNDASKGQKQQPAEKPATPPSDDKK
PQAKPASSDSKEAKETPPQGEKDASGNVISAKADALKGLTVLGKIELPKDRPKKKAKPVA
SSDERNKDKKKRPRKRIDKPGTGGPQGGNRGGGPQGGRGDNRNQGGRKRPGGNNKGGGKG
GNRFQKAEPTQKEIQDQIKQTLARLQGGGKSGGGKKTRRDKQRERAKDQQSEGIEESKVL
KVTEFISANDLASLLDVSVNEIISVCMSLGMFVSINQRLDAEAITIIADEFGYEVEFTKA
DEEEEVEEVEDSPEDLGDRAPIVTIMGHVDHGKTSLLDYIRSSKVTSGEAGGITQHIGAY
DVRTDNGDKIAFLDTPGHEAFTAMRARGAKITDVAIIVIAADDSIMPQTKEAINHAQVAG
VPMIFAINKIDKPNANPNKIKEELANMNLLVEDWGGKYQSQEISAKTGQGVDELLEKVLL
EAEILELKANPDRKAMGTVVEASLDKGRGYVSTVMIQNGTLKIGDIMLAGQHYGRVKAMF
DHLGQKVQEAEPSTPVQVLGLSGAPQAGDILKVYDTEREAREIANSREQINREQSMRTKK
HITLDEIGRRLAIGSFKELNIIIKGDVDGSVEALSDSLLKLSKDEVSVNIIHKGVGQISE
SDVLLASASDAIILGFQVRPSSSAKRLAEQEEIEIRHYSIIYDAINQIKDAIEGMLEPEF
EEVITGNIQVREVFKISKVGTVAGSYVTDGYVTRKNKIRVIRDGIVIHDGEIDQLKRFKD
DVSEVKAGYECGISIKGYNDIKLEDTIEGYEMREVKRKK