Protein Info for Echvi_0701 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR00435: cysteine--tRNA ligase" amino acids 6 to 493 (488 residues), 474.2 bits, see alignment E=2.8e-146 PF01406: tRNA-synt_1e" amino acids 20 to 339 (320 residues), 363.7 bits, see alignment E=1.7e-112 PF09334: tRNA-synt_1g" amino acids 36 to 118 (83 residues), 21.6 bits, see alignment E=1.7e-08 PF09190: DALR_2" amino acids 382 to 425 (44 residues), 41.3 bits, see alignment 3.8e-14

Best Hits

Swiss-Prot: 63% identical to SYC_CYTH3: Cysteine--tRNA ligase (cysS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 63% identity to chu:CHU_3418)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVD0 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Echvi_0701 cysteinyl-tRNA synthetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MISKELKIYNTLSREKELFEPFKPPFVGMYVCGPTVYGDAHLGHARPAVTFDTVYRYLKH
QGYKVRYVRNITDVGHLQGDADDGEDKIAKKAKLEQLEPMEVAQHYTDTYHRDMDLLNTF
KPNIEPRATGHIPEQIKLVQDILDAGFAYEVNGSVYFDVVKYNEEKPYGKLSGRVVEELM
SGSRELDGQDEKRNPIDFALWKNAAPEHLMKWDSPWGVGFPGWHLECTAMSSKYLGDQFD
IHGGGMDLMFPHHECEIAQGNAGHGHDPAKYWMHNNMITINGQKMGKSLGNFITLQELFN
GKHDLLEQAYSPMTIRYFILTAHYRSTLDFSNDALKAAQKGYKKIINGLRIAKDLHYVDA
EGVATDEKQVQQVEKSIENAYRAMNDDFNTAQAIGQLFNLLKKINSIFTGQLQAAALGKA
VFEKLIQTFIVFVEDILGLVEEKSDKQQALLELLLKLYKEAKLAKDYDKVDEIRAALKSI
GIVVKDMKEKVDWAYEE