Protein Info for Echvi_0696 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: galactokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR00131: galactokinase" amino acids 6 to 380 (375 residues), 330.4 bits, see alignment E=7.3e-103 PF10509: GalKase_gal_bdg" amino acids 9 to 56 (48 residues), 81.3 bits, see alignment 4.3e-27 PF00288: GHMP_kinases_N" amino acids 89 to 177 (89 residues), 80.5 bits, see alignment E=1.3e-26 PF08544: GHMP_kinases_C" amino acids 281 to 361 (81 residues), 31.5 bits, see alignment E=2.9e-11

Best Hits

Swiss-Prot: 40% identical to GAL1_ROSS1: Galactokinase (galK) from Roseiflexus sp. (strain RS-1)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 53% identity to psn:Pedsa_0637)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVC2 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Echvi_0696 galactokinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNPGIIRSAFEELFDKKPIVVKSPGRINLIGEHTDYNEGFVLPAAINKEIVIAVQKNDSD
ECRLFSQDFQESLTFDLHDFERMEGGWGNYVMGVVAQLQQAGYPIEGFDLVFGGDVPVGA
GLSSSAAVENGVCLALSELFGLGLERLDMLKFAQKAEHEFAGVQCGIMDQFASMMGKDNH
AIRLDCRSLEYSYFPIDLGDYQIILCDTQVKHSLADSAYNDRRRECQAGVAAVQQTNQTV
KSLRDVTLELLEETKSKISEVVFRRCKFVIEENARLLKGCELLEKGDIKGFGQQMYGSHD
GLSGLYEVSCKELDFLADFAKSRETVAGARMMGGGFGGCTINLVEKGAKETFEKEVAAAY
EKAFGKSLQIYEVEVTDGTRVVG