Protein Info for Echvi_0695 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): UDP-glucose--hexose-1-phosphate uridylyltransferase (EC 2.7.7.12)
Rationale: Specifically important for utilizing D-Galactose; this is part of the Leloir pathway
Original annotation: galactose-1-phosphate uridylyltransferase, family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00209: galactose-1-phosphate uridylyltransferase" amino acids 1 to 346 (346 residues), 488.4 bits, see alignment E=5.4e-151 PF01087: GalP_UDP_transf" amino acids 3 to 178 (176 residues), 224.1 bits, see alignment E=2e-70 PF02744: GalP_UDP_tr_C" amino acids 187 to 346 (160 residues), 175.5 bits, see alignment E=7.8e-56

Best Hits

Swiss-Prot: 52% identical to GAL7_HAEIN: Galactose-1-phosphate uridylyltransferase (galT) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00965, UDPglucose--hexose-1-phosphate uridylyltransferase [EC: 2.7.7.12] (inferred from 58% identity to psn:Pedsa_0636)

Predicted SEED Role

"Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.7.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.10 or 2.7.7.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUJ3 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Echvi_0695 UDP-glucose--hexose-1-phosphate uridylyltransferase (EC 2.7.7.12) (Echinicola vietnamensis KMM 6221, DSM 17526)
MTDFNFEDHSHRRYNPFTGDWLQVSPHRGKRPWQGQEEDTAEAQKPAYDEKCYLCPGNTR
INGEKNPDYTGAYVFQNDFGALTSDIPQGEMSEGEFFRAKSERGICKVICFSPRHDLTIP
ELDVQAITKVVELWKKEYQELGGKDFINHVQIFENKGSVMGCSNPHPHGQIWAQESIPVE
PAKKQVKFGEYYQKYGRSMVLDYVYEELKKGERILFENDYFVGLVPFWAVWPFEAMIAPK
THIASLSEMDAAQMEALADAYRQLAIMYDNVFKVSFPYSAGIHQAPTDGQNHPEWDLHMV
FYPPLLRSATVKKFMVGYEMLANPQRDITAESAVKILKSQPKEHYKV