Protein Info for Echvi_0680 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details signal peptide" amino acids 24 to 27 (4 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 51 to 355 (305 residues), 257.2 bits, see alignment E=9.3e-81 PF25917: BSH_RND" amino acids 76 to 202 (127 residues), 31.6 bits, see alignment E=3.1e-11 PF25973: BSH_CzcB" amino acids 79 to 201 (123 residues), 33.6 bits, see alignment E=7.4e-12 PF25954: Beta-barrel_RND_2" amino acids 209 to 280 (72 residues), 47 bits, see alignment E=6.2e-16 PF25944: Beta-barrel_RND" amino acids 231 to 281 (51 residues), 35.1 bits, see alignment 3.7e-12 PF25967: RND-MFP_C" amino acids 286 to 345 (60 residues), 41.1 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: None (inferred from 41% identity to chu:CHU_2657)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUH5 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Echvi_0680 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKQTKILVIVAIVVVIAVIFLFPRLQGGDTSKEPSKSPQSTPEAMTALPVDVVEVTPER
LENNLNVTGNVLSNESVSLRAEITGLVESINFEEGQFVKKGTPLVYLNDDELTAQLDRLE
YTKKLYEGQESRQKQLLAREAISQEEYDIILNQYNTTLSDIKLVKAQLDKTVIKAPFDGV
LGLRQISAGSVISTTDIIANIVNIDPIKIEFSIPERYASQVQVGSTIEFSNNASHGLKKG
KVYAYEPVIDANTRTLTLRAISPNEDRKFLPGMFVNIRFNLEVEEDALLVPSQSLIPELN
GYKLFLVNQEGIVQERQVQIGIRTDSEVQILDGLSPGEMVLTTGVLQAKEGMKVKYNKIN