Protein Info for Echvi_0672 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: lipoate-protein ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to LIPB_GRAFK: Octanoyltransferase (lipB) from Gramella forsetii (strain KT0803)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 72% identity to dfe:Dfer_3712)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

lipoate biosynthesis and incorporation I (2/2 steps found)
lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSQ2 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Echvi_0672 lipoate-protein ligase B (Echinicola vietnamensis KMM 6221, DSM 17526)
MVLITINHWKEYVVNHFINKKVKFIDLGKKDYKETWDYQESLFADIVATKIENRKKAPSD
QVTTTNYLLFVEHPHVYTLGKSGELTHLLLDEAQLAEKQARFYKINRGGDITYHGPGQLV
GYPLLDLDNFFTDIHKYLRLLEEAIILTLADYGVAAGRIEGLTGVWLDHEKRMNPRKICA
LGVKSSRWVTMHGFAFNVNADLSYFGNIVPCGIADKAVTSLHLELGRPVDELEVKEKVKQ
HLADLFEMEWEE