Protein Info for Echvi_0664 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF01209: Ubie_methyltran" amino acids 65 to 185 (121 residues), 56.8 bits, see alignment E=1.1e-18 PF03141: Methyltransf_29" amino acids 71 to 180 (110 residues), 24.6 bits, see alignment E=4.8e-09 PF00891: Methyltransf_2" amino acids 72 to 190 (119 residues), 35.6 bits, see alignment E=3.2e-12 PF05401: NodS" amino acids 73 to 178 (106 residues), 37.3 bits, see alignment E=1.3e-12 PF13489: Methyltransf_23" amino acids 73 to 196 (124 residues), 49.9 bits, see alignment E=1.5e-16 PF13847: Methyltransf_31" amino acids 75 to 188 (114 residues), 63 bits, see alignment E=1.4e-20 PF05175: MTS" amino acids 75 to 203 (129 residues), 29.2 bits, see alignment E=3.2e-10 PF13649: Methyltransf_25" amino acids 78 to 176 (99 residues), 82 bits, see alignment E=2.1e-26 PF08241: Methyltransf_11" amino acids 78 to 179 (102 residues), 80.4 bits, see alignment E=6.5e-26 PF08242: Methyltransf_12" amino acids 78 to 178 (101 residues), 68.5 bits, see alignment E=3.6e-22

Best Hits

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 56% identity to shg:Sph21_2817)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUG0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Echvi_0664 Methylase involved in ubiquinone/menaquinone biosynthesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKKVRPFLQSTVNTLILPPITMTKKSTIAEIEKRFDSDVDRFSNIETGQSSTVDALFNM
ELITDGIAQLYPNLTQLLDIGCGAGNFSVKLLSKVLAPTNVTLADLSQPMLDRAKERTTP
LTEGEVTTVKGDFRNLPLPEKSFEVIIATAVLHHLRDDEDWKSAFEKLFRLLKPGGSLWV
FDLVAHDDPKIQDLLYRQKYGQFLTHLKDENYRDHVFDYIEKHCCPVNPDIS