Protein Info for Echvi_0662 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00561: Abhydrolase_1" amino acids 12 to 115 (104 residues), 89.1 bits, see alignment E=1.3e-28 PF00975: Thioesterase" amino acids 13 to 120 (108 residues), 37.3 bits, see alignment E=1.3e-12 PF12697: Abhydrolase_6" amino acids 14 to 246 (233 residues), 69.1 bits, see alignment E=3.1e-22 PF12146: Hydrolase_4" amino acids 14 to 240 (227 residues), 60 bits, see alignment E=7.8e-20 PF03096: Ndr" amino acids 58 to 252 (195 residues), 23.6 bits, see alignment E=6.9e-09

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 51% identity to mtt:Ftrac_1787)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.7.1.-

Use Curated BLAST to search for 3.1.-.- or 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW94 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_0662 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLNYKKVGQGKPLIILHGLFGSADNWLSIAKELEEDYTMYLVDQRNHGDSPHSEEWSYK
SMVDDLAAFMTSQGLEAAYIMGHSMGGKTAMNFALKYPNKVQKLIIADIAPRYYPPHHEN
ILAGLNAIDMDHLASRKEADETLAEHIPEMGIRQFLMKSLGRDENRKFVWKINLPVITEK
IDNVGAEIESDKSYAGPTLFMRGANSDYIQEKDKEDLEKYFPEYKLITIKNAGHWLHAEQ
PDAVVETIKAFLG