Protein Info for Echvi_0656 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF01513: NAD_kinase" amino acids 53 to 120 (68 residues), 60.8 bits, see alignment E=1.7e-20 PF20143: NAD_kinase_C" amino acids 145 to 248 (104 residues), 100.4 bits, see alignment E=6.4e-33

Best Hits

Swiss-Prot: 57% identical to NADK_CYTH3: NAD kinase (nadK) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 56% identity to mtt:Ftrac_1778)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSN5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Echvi_0656 Predicted sugar kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKITIHGISFQKEFVPYIEKLIAVLHGHGTDLFLTETFSKYLKKSGAKATGFTVLGERKE
LAGMDFVISVGGDGTLLDTVSLVGEYEVPIVGINTGRMGFLATIAKEDVEKAVQVLFDGD
FTIQDRILINLEADQKLFNGVPYGLNEFTIHKRDTSSMIIVHTYIDGEYLNSYWADGLIV
ATPTGSTGYSLSCGGPLISPSAKNFVITPVSPHNLNVRPMIVSDESEITFSIEGRSKKFL
ISLDSRSTAVDASVKLKVKREKFVARLVKFHDYSFFDTLRKKLNWGFDMRN