Protein Info for Echvi_0645 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details PF18955: DUF5698" amino acids 36 to 93 (58 residues), 82.6 bits, see alignment E=2.1e-27 PF10035: DUF2179" amino acids 128 to 176 (49 residues), 27.3 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 45% identical to Y1511_METMJ: UPF0316 protein Memar_1511 (Memar_1511) from Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

KEGG orthology group: None (inferred from 55% identity to mtt:Ftrac_2187)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV67 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Echvi_0645 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MQEFFSGMGMDEDMFTYVVMPLLIFLARVGDVTINTLRIMFVLNGKKNVAPILGFFEALI
WLLAIGQIFQNIDNPMSYLAYAGGFGAGTYIGMVIEEKLALGRVLVRVITKEPMPELIEY
MKERDFRFTNVGAEGRYGKVNLLFTVMKRESLKGFIGKIKSLNDKAFYTIESVKRISEDD
LNVMEDRPRFTTRVFNRVRK