Protein Info for Echvi_0637 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Serine phosphatase RsbU, regulator of sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details PF07228: SpoIIE" amino acids 488 to 684 (197 residues), 156.7 bits, see alignment E=6.9e-50

Best Hits

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW69 at UniProt or InterPro

Protein Sequence (688 amino acids)

>Echvi_0637 Serine phosphatase RsbU, regulator of sigma subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKFPNINIGRILILVTVLTWLGLLFVDLLRLFGTVNRMNLGIAHEITWTLEIIFFVLVY
LFYSRSIERSEQNNFIQLIWRAASTGLIVIGVAFLIRVFYILLDDTRLSTDPLLGNFFYH
VNFGLTTLFLISCSLLWKKLILYQKNKNTVQQWQIYEVMLLVSMFYVYFNQNTFDFTFLF
GLVFLLIFGVIISVNLKWIPYLTFKDKWKSILFFVIILITTSFLFMQSLSHQSHHAEINL
MDNLFLMGLFGFVFVYSLFSFLVTLFNLPTSSVFEQKLTEAINFQKLSQSIQPGQSETQV
LDILVDSCMSAAYADAAWLEIVDEENQLQILHQRFVTNMDRKEIKALMDKNKVFSSFLSL
RKPSATDHVNSGVEHDLYKSALVVPIWVNKSLLGYLFLLKEVKNGFNKEMLNIVTTFVGQ
ASISVENHRLLNEAIKNERYKEELKIAQRVQRSLLPSALHHNSHFDIFGFSEAADEVGGD
YYETYQFDENRFALIIGDVSGKGLSAAFNMSQMKGVFHSLVQLDLSPKEFLSKANNALSS
CLAKNLFITTTYYLIDTAKATITFCRAGHCPTLYYDSKAGEAGYITLEGMGLGILRSDKY
PEYLHEKTIHYQPGDILVMYTDGIIESKDQNGEEFGYERLKEVLNTYKDQSPEKIKNHLI
QAVYEFVGEAALPDDDYSLMVLKFLEQH