Protein Info for Echvi_0628 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: putative oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase" amino acids 4 to 363 (360 residues), 286.8 bits, see alignment E=1.2e-89 PF04055: Radical_SAM" amino acids 5 to 167 (163 residues), 97.8 bits, see alignment E=8.2e-32 PF06969: HemN_C" amino acids 298 to 364 (67 residues), 49.8 bits, see alignment E=2.8e-17

Best Hits

Swiss-Prot: 33% identical to HEMW_BACSU: Heme chaperone HemW (hemW) from Bacillus subtilis (strain 168)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 50% identity to mtt:Ftrac_2551)

Predicted SEED Role

"Hypothetical radical SAM family enzyme, NOT coproporphyrinogen III oxidase, oxygen-independent" in subsystem Heat shock dnaK gene cluster extended or Heme and Siroheme Biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVW6 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Echvi_0628 putative oxygen-independent coproporphyrinogen III oxidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MAGIYIHIPFCRQACHYCDFHFSTSTALKDKMVRMICRELQLQKDYLGRGTPIKTIYFGG
GTPSLLSAEALAEILETISLHYPLELEETTIETNPDDLNPAMLQSLKTLGFDRLSIGIQS
FSEEVLRFYNRAHTATESLKSIDLARKMGFDKLSIDLMYGFPAKDHQLWNHDLRQAIQLA
PGHISSYCLTIEPDTALGKWAQKGSFNPASEDFCAEQFEVMQNQLEDAGYVQYEISNFGK
PDAFAVHNSNYWKGIPYLGIGPSAHSFDGRSRQHNIANNPKYIKALDNETVPFEKDVLSQ
EDILNEYLLTALRTIWGVDLQKVKETFGVDLMHIHAPLIQQLSQEKLIETNTRHLRLTKQ
GKLLADYIAGKLFV