Protein Info for Echvi_0600 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-serine dehydratase, iron-sulfur-dependent, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR00718: L-serine dehydratase, iron-sulfur-dependent, alpha subunit" amino acids 9 to 288 (280 residues), 264.8 bits, see alignment E=4.4e-83 PF03313: SDH_alpha" amino acids 18 to 275 (258 residues), 264.5 bits, see alignment E=6.1e-83

Best Hits

Swiss-Prot: 41% identical to SDHA_PEPAS: L-serine dehydratase, alpha chain (sdhA) from Peptoniphilus asaccharolyticus

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 80% identity to mtt:Ftrac_1933)

MetaCyc: 41% identical to L-serine dehydratase alpha subunit (Peptoniphilus asaccharolyticus)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV16 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Echvi_0600 L-serine dehydratase, iron-sulfur-dependent, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MSYLFETFQGWKEYCEAKNVPLYAPVMEYEKDQRGKSEEQIWEGLRSAYKVMKDAVETGL
KEEMVSRSGMINNGAKKVYHHPLSVLSPEFQRLISRALAAKEVNSCMGRVVAAPTAGASG
ILPGTLYTLQEIHGLSDDKVLEGLLIGAGVALIIEQNASLAGAVGGCQAETGSAAAMASG
AMVYCLGGNTDQVFNAVAITIQCMLGLVCDPVAGLVEIPCVVRNASAAAIANSSAQIALA
DVSGVIPVDECVEAMGEIGASMENKYKETALGGLAATLTGKGIAKKVLIQDIEILPDEES
TD