Protein Info for Echvi_0600 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-serine dehydratase, iron-sulfur-dependent, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00718: L-serine dehydratase, iron-sulfur-dependent, alpha subunit
  • amino acids 9 to 288 (280 residues), 264.8 bits, E=4.4e-83
• PF03313: SDH_alpha
  • amino acids 18 to 275 (258 residues), 264.5 bits, E=6.1e-83

Best Hits

Swiss-Prot: 41% identical to SDHA_PEPAS: L-serine dehydratase, alpha chain (sdhA) from Peptoniphilus asaccharolyticus

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 80% identity to mtt:Ftrac_1933)

MetaCyc: 41% identical to L-serine dehydratase alpha subunit (Peptoniphilus asaccharolyticus)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See L0FV16 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Echvi_0600 L-serine dehydratase, iron-sulfur-dependent, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MSYLFETFQGWKEYCEAKNVPLYAPVMEYEKDQRGKSEEQIWEGLRSAYKVMKDAVETGL
KEEMVSRSGMINNGAKKVYHHPLSVLSPEFQRLISRALAAKEVNSCMGRVVAAPTAGASG
ILPGTLYTLQEIHGLSDDKVLEGLLIGAGVALIIEQNASLAGAVGGCQAETGSAAAMASG
AMVYCLGGNTDQVFNAVAITIQCMLGLVCDPVAGLVEIPCVVRNASAAAIANSSAQIALA
DVSGVIPVDECVEAMGEIGASMENKYKETALGGLAATLTGKGIAKKVLIQDIEILPDEES
TD