Protein Info for Echvi_0594 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR01203: hypoxanthine phosphoribosyltransferase" amino acids 31 to 192 (162 residues), 173 bits, see alignment E=2.2e-55 PF00156: Pribosyltran" amino acids 37 to 179 (143 residues), 89.4 bits, see alignment E=8.1e-30

Best Hits

Swiss-Prot: 45% identical to HPRT_ENTFA: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 51% identity to psn:Pedsa_3015)

MetaCyc: 36% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU96 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Echvi_0594 hypoxanthine phosphoribosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIIYICIALESGLFYCNMLKVKDKEFELYLSEEQLGVRVKALGKALSKDYDGKCPLVLG
ILNGAFMFLSDLMKEVSVPLEVSFIKIASYEAMQSTGSIQELVGLKEEVKERHIIIVEDI
VDTGRSMGHLIDKLREKSPASIAVASLLLKPEALLTEVEVDYVGFEIPNKFVVGYGLDYD
GHGRNLREIYQLK