Protein Info for Echvi_0590 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DnaJ-class molecular chaperone with C-terminal Zn finger domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 100.3 bits, see alignment E=7.8e-33 PF01556: DnaJ_C" amino acids 125 to 332 (208 residues), 149.3 bits, see alignment E=1.4e-47 PF00684: DnaJ_CXXCXGXG" amino acids 153 to 199 (47 residues), 42.1 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 52% identical to DNAJ_PORG3: Chaperone protein DnaJ (dnaJ) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 72% identity to mtt:Ftrac_1941)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV08 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Echvi_0590 DnaJ-class molecular chaperone with C-terminal Zn finger domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKRDYYEVLGLSKGAGADEIKKAYRKMALKYHPDKNPGDQEAEEKFKEAAEAYEVLSNP
EKKQRYDQFGHQGVSGNGGFGGGGGMNMDDIFSQFGDIFGGGGGFESFFGGGRGGGRRMR
KGTNLRVKLKVNLKEVANGVEKKIKVKRHMVADGVSFKTCSTCQGSGQVKKVVNTMLGQM
VSASACPNCGGTGQIIDKKPDHADARGLILKEEVIPINIPAGVADGMQLSLSGKGNEIPG
GVAGDLLIVIEEIEHDILQRDGNNVVYDLYVNFVDAALGAHIEVPTIESKVKIKLEPGTQ
SGKILRLKGKGIKDLNGFGRGDELIHVNVWTPQQLTKEEKEKLESLRESENFIPAPGKSE
KTFFDKMKEFF