Protein Info for Echvi_0588 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type uncharacterized transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00005: ABC_tran" amino acids 19 to 159 (141 residues), 95.8 bits, see alignment E=5.4e-31 PF13304: AAA_21" amino acids 129 to 191 (63 residues), 27.1 bits, see alignment E=6.6e-10 PF13732: DUF4162" amino acids 213 to 294 (82 residues), 49.9 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 56% identity to kdi:Krodi_2018)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVS7 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Echvi_0588 ABC-type uncharacterized transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MDILKIDGLNKRYGEQAALTDVDLVVPKGGVFGLLGPNGAGKTTLIRIINQIIDGDSGSV
FLKGEPLSPKHIKNIGYLPEERGLYKRMKVGDQLIYFARLKGLNGHDARTKVAGWLKKLD
IQAWSEKKIEDLSKGMAQKVQFIATVIHDPEILILDEPFSGFDPVNAEVIKNEMLELKEK
GTTVMLSTHRMESVDLLCDHIAMINKSRKVLDGPLAQIKDQSRSNIYKVKLQGTDIALPA
KCHHPKEEYGVTSFEVTLENGTPNDLLREVMGLGEVVSFEERIPTIEEIFIQKVKEHAQ