Protein Info for Echvi_0584 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 TIGR00503: peptide chain release factor 3" amino acids 14 to 535 (522 residues), 697 bits, see alignment E=1.4e-213 PF00009: GTP_EFTU" amino acids 22 to 285 (264 residues), 175.7 bits, see alignment E=1.6e-55 TIGR00231: small GTP-binding protein domain" amino acids 23 to 183 (161 residues), 83 bits, see alignment E=2e-27 PF01926: MMR_HSR1" amino acids 25 to 151 (127 residues), 29.3 bits, see alignment E=1.6e-10 PF22042: EF-G_D2" amino acids 303 to 389 (87 residues), 86.9 bits, see alignment E=1.6e-28 PF16658: RF3_C" amino acids 395 to 522 (128 residues), 154.3 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 57% identical to RF3_PELCD: Peptide chain release factor 3 (prfC) from Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 77% identity to mtt:Ftrac_2846)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU85 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Echvi_0584 peptide chain release factor 3 (Echinicola vietnamensis KMM 6221, DSM 17526)
MHLAIKGARRKMSLTKEIQRRKTFGIISHPDAGKTTLTEKLLLFGGAIKTAGAVKSNKID
THAKSDWMEIEKQRGISVATSVMGFEYKGNKINLLDTPGHQDFAEDTYRTLTAVDSVIMV
IDCVKGVEIQTEKLMEVCRMRNTPVICFINKLDREGRDPYDLLDEVEDKLNIKVRPLSWP
ISMGKTFKGVYNLYNKSLNLFRPSQRKLADDIMAIEDLSDSKLEDLVGDNNANQLREDVE
LIEGVYPEFDKGAYLRGEIAPVFFGSAVNNFGVQEMLDTFIDIAPSPKSRHAEEREVSPE
EDKFSGFVFKIHANMDPNHRNRIAFLRICSGKFERNKPYKSMRAPKPLRFSNVTSFMAQD
KEIIEEAFPGDIVGLYDTGNLKIGDSLSDGESLTFRGIPSFSPEIFREVINKDAMKTKQL
EKGLKQLMEEGVAQLFTFDMGSRKVIGTVGQLQFEVIQFRLKNEYNATVEFAPMNLYKAC
WISSNDKKQLDEFVRSKNRHIAYDKEGKLVFMAESRAWLQMVQDNYPDIEFHFTSEF