Protein Info for Echvi_0577 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): Ornithine aminotransferase (EC 2.6.1.13)
Rationale: Specifically important for utilizing L-Arginine. Automated validation from mutant phenotype: the predicted function (ORNITHINE-GLU-AMINOTRANSFERASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: ornithine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01885: ornithine--oxo-acid transaminase" amino acids 8 to 409 (402 residues), 662.1 bits, see alignment E=1.3e-203 PF00202: Aminotran_3" amino acids 20 to 408 (389 residues), 410.8 bits, see alignment E=2.7e-127

Best Hits

Swiss-Prot: 61% identical to OAT_DROAN: Ornithine aminotransferase, mitochondrial (Oat) from Drosophila ananassae

KEGG orthology group: K00819, ornithine--oxo-acid transaminase [EC: 2.6.1.13] (inferred from 73% identity to mtt:Ftrac_2019)

MetaCyc: 61% identical to Ornithine aminotransferase (Homo sapiens)
Ornithine aminotransferase. [EC: 2.6.1.13]

Predicted SEED Role

"Ornithine aminotransferase (EC 2.6.1.13)" in subsystem Arginine and Ornithine Degradation or Dimethylarginine metabolism (EC 2.6.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW07 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Echvi_0577 Ornithine aminotransferase (EC 2.6.1.13) (Echinicola vietnamensis KMM 6221, DSM 17526)
MMQPITSSQQAIELENKHGAHNYHPLPVVLSRGEGVFMWDVEGEKYYDFLSSYSAVNQGH
CHPRILQTLIDQAGTLTLTSRAFHNDVLGPFEKFLTEYFGYDKVLPMNTGAEGVETAIKI
ARKWGYEKKGIPENEGTIIVAKNNFHGRTTTVISFSNDETARKNFGPYTPGFVTIPHDDI
DALKDVLSQSKNIIGYLVEPIQGEAGVYVPKEGYLKEVAAVCKDHGVLFMADEIQTGIAR
TGKLLACDHEGVKPDMLILGKAISGGFYPVSAVLADDHIMEVIQPGQHGSTFGGNPLGAK
VAMTALNVVKDEKLAENADKLGKLFRERIQQLVDKSDLVELVRGKGLLNAIVINDTEDSD
TAWRLCLALKENGLLAKPTHGNIIRFAPPLVITEEQLHDCCDIIEKTIQNFKK