Protein Info for Echvi_0510 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 66 to 82 (17 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 64 to 323 (260 residues), 117.1 bits, see alignment E=2.2e-37 PF13407: Peripla_BP_4" amino acids 66 to 316 (251 residues), 68.4 bits, see alignment E=1.5e-22 PF13377: Peripla_BP_3" amino acids 175 to 335 (161 residues), 111.4 bits, see alignment E=1e-35

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 45% identity to bth:BT_3613)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FS81 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Echvi_0510 Transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKKRVTLKDIASELGISISTVSRALKDHPDIDKGLTKKIKALAQRWNYIPNPLAMGLLR
QQTRVIGVIVPDLVTYFFSSIISGIEDELQQAGYYIVISSSKESLEKEIECVHNLLNLRI
DGLIVCLAQNSHQTDHFKKVLDHDVPLVFFDRVCLEKEVSTVVVDNVSMAKDITTHFYEN
GARRIAHITGPKHLNIVQERAEGYLKGLQEVGLPFEKKYLAHTDLSHQSTEKAIKKLLQL
PQRPDAILGVNDTVIFATMKAIKAAGLKIPHDILLAGFSDEFHATVVEPNLTSVAHPTHE
IGRNAAKLILEQIKEEKAIQKKIVLNTALYIRASSSRSKK