Protein Info for Echvi_0508 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-fucose:H+ symporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 55 to 75 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 16 to 416 (401 residues), 456.6 bits, see alignment E=4.9e-141 PF07690: MFS_1" amino acids 25 to 366 (342 residues), 67.8 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 40% identical to FUCP_ECOLI: L-fucose-proton symporter (fucP) from Escherichia coli (strain K12)

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 56% identity to etr:ETAE_0291)

MetaCyc: 40% identical to L-fucose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7221; RXN0-7222; TRANS-RXN-20

Predicted SEED Role

"Fucose permease" in subsystem L-fucose utilization or L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU11 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Echvi_0508 L-fucose:H+ symporter permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNPSKSALVSKATLWPFILLTSLFLLWGLANNMTDTLLAAFKKILSMTDTQTSFIQLAF
YGAYFCLALPAAIYIKKYTYKSGVLLGLGLFAVGGLLFYPASITMSYGFFLFALYVLAGG
LSILETSANPYIMVMGPEASATRRLNLAQSFNPVGSIIGVVLSKFFILSKLNVAEADERS
RMTAEQLQQVRQEELDAVMGTYVGVALFLVVMWVLIKFTKMPTASEGGLQDSLGNGLKRL
LGNKNYVFGVLAQFFYVGAQIGIWSYTIRYVMMELDMNESDASNYYLAAIVLFTVSRFLF
TALMKFVRPSLLMAISAIGAIGLTMVVIFGHGMVGSIALVCISGCMSLMFPTIYGLAAEG
LGDDTKLGGSGLIMAILGGAIFPFIQGLVSDSLDSIHLSFFVPAACYLVVVAYGLFHYKH
KKEIPAMAAGE