Protein Info for Echvi_0507 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Threonine dehydrogenase and related Zn-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF08240: ADH_N" amino acids 24 to 129 (106 residues), 86 bits, see alignment E=2.9e-28 PF16912: Glu_dehyd_C" amino acids 158 to 334 (177 residues), 37.3 bits, see alignment E=3.1e-13 PF00107: ADH_zinc_N" amino acids 169 to 296 (128 residues), 90.8 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 34% identical to DHSO_BACHD: Sorbitol dehydrogenase (gutB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: None (inferred from 67% identity to dfe:Dfer_5642)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVK1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Echvi_0507 Threonine dehydrogenase and related Zn-dependent dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKILTCTEPGNFEYSEGEKPTLSPGRAIIKIKRIGICGTDLHAYEGTQPFFNYPRVLGHE
LSGELVEVDGAEGFVPGDLVTIIPYFNCGECVACKAGKPNCCATISVFGVHEDGGMKEFI
SVPSSSLVKQEGLSLEQLALAEPLAIGAHGVRRAGVQPGEFVVVMGAGPIGLGVMEFARI
AGGKVIAMDINEDRLAFCRETLGVEYTVNAKGDFKAAIADITGGSFAESVIDATGSSVAI
HHGFGLMAHGGRYVLVGLQKGPIEFNHPEFHKRESTLMSSRNATREDFDTVLKALKEQKV
KAASYITHEVAFDQVKADFASWLDPANKVIKAMVRLQ