Protein Info for Echvi_0500 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Beta-xylosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04616: Glyco_hydro_43" amino acids 34 to 312 (279 residues), 144.1 bits, see alignment E=6e-46 PF00251: Glyco_hydro_32N" amino acids 42 to 183 (142 residues), 22.6 bits, see alignment E=7.2e-09

Best Hits

KEGG orthology group: None (inferred from 73% identity to zpr:ZPR_2143)

Predicted SEED Role

"Hypothetical glycoside hydrolase, family 43, similar to arabinosidase" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FS72 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Echvi_0500 Beta-xylosidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNIKTFSCAVALLTVAIPGYSQQAITEKTPITPGNPVITEKYTADPAAIVHEDTVFLYVG
HDQAPPKKDFYEMHEWLIYSSTDMVNWEERAAVNVKETFDWAAGDAWAAEVIEKDGKFYW
FVTVSHKEIHGKAIGIAVSDSPVGPWKDALGHALITNDMTTDTKISWDDIDPTVFIDDDG
SAHLFWGNTICYYAKLKDNMLELDSEIQYIDLPNFTEAPWIHKKGDFYYLSYAYKFPEKT
AYAMSESIDGPWKYQGILNEVAGNSNTNHQAIIEYKGKDYFIYHNGSIPTHGGSFRRSVC
IDYLYYNPDGTIKKIIMTSEGIDPAE