Protein Info for Echvi_0499 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyl hydrolases family 43.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF22847: BT_3657-like_N" amino acids 22 to 167 (146 residues), 215.4 bits, see alignment E=4e-68 PF00251: Glyco_hydro_32N" amino acids 41 to 177 (137 residues), 26.5 bits, see alignment E=7.2e-10 PF04616: Glyco_hydro_43" amino acids 70 to 254 (185 residues), 34.6 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 60% identity to hhy:Halhy_1539)

Predicted SEED Role

"Beta-galactosidase (EC 3.2.1.23)" in subsystem Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Lactose utilization (EC 3.2.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.23

Use Curated BLAST to search for 3.2.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUS1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Echvi_0499 Glycosyl hydrolases family 43. (Echinicola vietnamensis KMM 6221, DSM 17526)
MKHSLLTFCLLLGLFTLGFAQSGEVYLFSYFMGNGEDGLHLAYSKDGLHWKALNDNKSIL
TPTAGGDKLMRDPCIIRGGDGKFHMVWTVSWNEKGLGYASSEDLIHWSEQQFIPVMAHEE
GARNTWAPEVFYDDKKDRYMLFWSTTIKGRYPETQDTLESAYNHRMYYTTTKDFKKFSKT
KLFYEPCFNVIDGTIIPHDGEYVLFVKDETRTPPAKNIRVTKSRKLTKGYPVAGTPITGD
YWAEGPTPLMVDGRCILYFDKYINHQMGAVASTDFENWEDISDEISFPAGTRHGTAFKVS
QEEFKALKEAFEQ