Protein Info for Echvi_0347 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Phosphate starvation-inducible protein PhoH, predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF02562: PhoH" amino acids 106 to 309 (204 residues), 314 bits, see alignment E=8.1e-98 PF13604: AAA_30" amino acids 111 to 263 (153 residues), 32 bits, see alignment E=2.2e-11 PF13245: AAA_19" amino acids 113 to 262 (150 residues), 33.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 67% identity to sli:Slin_1917)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUE1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Echvi_0347 Phosphate starvation-inducible protein PhoH, predicted ATPase (Echinicola vietnamensis KMM 6221, DSM 17526)
MVEKVITLENIPLLDFLGTENENIRQIAAAFPKSKIVSRGNEIRIQGRAPEIIRINDVLN
MLLQHFNRFGQVTPENVKEYIELEGVPFEEDPKNDIIVYGNKGLAIKPKSTNQRKLVDAA
FKNDLVFALGPAGTGKTYIAVALAVRALKNREVKRIIITRPAVEAGENLGFLPGDLQEKL
DPYLRPIYDALGDMVPAEKLKFYQENRVIEIAPLAYMRGRTLNDAFVLLDEAQNTTREQI
KMFLTRMGPNSKVIINGDQSQVDLPSKQKSGLREALRVLKDVKGIGLVNLSGKDVIRHKL
VKSIIEAYDRDDQHKEAFKNEQNNRQKGNG