Protein Info for Echvi_0343 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Enoyl-CoA hydratase/carnithine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 110 to 111 (2 residues), see Phobius details amino acids 136 to 150 (15 residues), see Phobius details PF00378: ECH_1" amino acids 9 to 258 (250 residues), 186.5 bits, see alignment E=5.8e-59 PF16113: ECH_2" amino acids 14 to 197 (184 residues), 94.3 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 58% identity to mtt:Ftrac_1366)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 4.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRT6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Echvi_0343 Enoyl-CoA hydratase/carnithine racemase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEEHVKFEQKGRIGYVILSRPEKRNALNAAMVSGLQAALDRCEAIETVKVVIIKAEGKVF
CSGADLQDIERMQDNTFDENLADSEGLKKLFLRLYTFPKVVIAQVQGHALAGGCGLVSVC
DFAYAVPTAKLGYTEVRIGFVPAMVLVFLVRKLGEGKAKELLLTGELLVAPAAKEIGLIQ
EVFEPAALDGAVQEIAERLISQNSGESMALTKKMIAAVQDLPLEEALEYAARMNAKARET
EDCKRGIAAFLGKKKIEW