Protein Info for Echvi_0342 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-dependent DNA helicase, RecQ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 7 to 339 (333 residues), 396.4 bits, see alignment E=9.3e-123 PF00270: DEAD" amino acids 19 to 179 (161 residues), 85.7 bits, see alignment E=4.7e-28 PF00271: Helicase_C" amino acids 215 to 320 (106 residues), 81.3 bits, see alignment E=9.4e-27 PF16124: RecQ_Zn_bind" amino acids 520 to 567 (48 residues), 51.2 bits, see alignment 2.6e-17

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 55% identity to mtt:Ftrac_1364)

Predicted SEED Role

"ATP-dependent DNA helicase, RecQ family" in subsystem DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUD6 at UniProt or InterPro

Protein Sequence (640 amino acids)

>Echvi_0342 ATP-dependent DNA helicase, RecQ family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTKALSVLKKVFGYDDFRPMQLDIVLSVAAGKDTLALLPTGGGKSICFQVPALMQEGIC
VVVSPLIALMKDQVDNLRKRGVLATAIYSGMRKREIDTTLDNCIYGNYKFLYVSPERLKS
DLFIERFKRMKVNMVAIDEAHCISQWGYDFRPPYLEIAALREYHPDTPFIALTASATLQV
KQDILEKLALRDPAVFVKSFARKNLSYAVRKAENKLEKAIEILQKVGGSAIVYVRSRKAT
KELAQALYRLGISATFYHAGLDKQLREQRQMEWKNNKVRVMVATNAFGMGIDKPDVRVVI
HVDLPENLENYYQEAGRAGRDEWKAFAVLLYQDKDLEVLVERAEQSYPPIDFIKRVYQSL
ANYYRIAVGSSLMVSYDFDIIAFTNTYHLDLLMTYNALKILQEEALVELSEGYYSPSTFH
FLIGQSRLYEYQIAHAALDPVIKVLLRMYGGELFSEYLKIREDKLATVLNIPEREVVKLL
ERMDNLDIAAYNKKKDQPQVTFLTHRYDAGRLPLNTKRIAERRDTSVEKAKAMVAYVTNT
TMCRTRQLLAYFGEVSDTSCGVCDVCLEKKKAANAPNYQEEVREKLLQTLADGDAFTYQD
LLAKANLSSTDPYATKLLRVMEDEGEIVSLADGRIKIKNE