Protein Info for Echvi_0324 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein involved in methicillin resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF02388: FemAB" amino acids 19 to 251 (233 residues), 56.4 bits, see alignment E=2.4e-19 amino acids 257 to 358 (102 residues), 69.4 bits, see alignment E=2.7e-23 PF13480: Acetyltransf_6" amino acids 187 to 313 (127 residues), 45.4 bits, see alignment E=9e-16

Best Hits

KEGG orthology group: None (inferred from 62% identity to cts:Ctha_2487)

Predicted SEED Role

"femAB family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVD1 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Echvi_0324 Uncharacterized protein involved in methicillin resistance (Echinicola vietnamensis KMM 6221, DSM 17526)
MTCTAERTSVDQINATNILPQTPFWAKVKHKQGFKPNGFRLKVSKALLDPYAGASQQLEE
DLLILLKDIGEGHCFAYVPYGPKLEPRFEHQGLFLEKLSESLRPHLPEHCVFIRYDLLWE
NQWADEQELYDPKGNWQGPPPVQTQEFRVNFNTDHWNLRKSPGDALPKNTFFLDLDRGSE
ELLYEMRYNTRYNIRQANKKGVEVREYGVEKLDDWYALYEETGIRKGITYQTKDYFLDLF
AHQDEQVRVCLLMASHEGQELASMLLVLSHKRATYLFGASASDQRQAMASYALQWEAIKR
AKAFGCEEYDMFGCAPNLDRSHPLHGVHLYKKGFGGQLFHRMGCWDYPFQEKGYEMFKAQ
EMNN