Protein Info for Echvi_0318 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: mraZ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF02381: MraZ" amino acids 4 to 76 (73 residues), 52.6 bits, see alignment E=1.9e-18 amino acids 78 to 143 (66 residues), 52.1 bits, see alignment E=2.7e-18 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 5 to 141 (137 residues), 121 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 49% identical to MRAZ_CYTH3: Transcriptional regulator MraZ (mraZ) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03925, MraZ protein (inferred from 57% identity to mtt:Ftrac_3285)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRR3 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Echvi_0318 mraZ protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MGNFSSEYYCKLDAKGRLVLPAKLKAALPETFGNELVMRRGFDPCLVLYPMNEYRKLDNK
VSALDDFDPKQRNFKRSFYRGNTEIELDSTGRFLIPKPLLGFAGISKEVIVVGMGKTIEI
WDPERYDNFLINDPEVFADQARTYLSDANK