Protein Info for Echvi_0316 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 48 to 69 (22 residues), see Phobius details PF19579: FtsL_2" amino acids 44 to 130 (87 residues), 82 bits, see alignment E=1.3e-27

Best Hits

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTI9 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Echvi_0316 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MEGNTFKKKIKKRGSNESRRSGKPANSKNVFALIEEKLKMSNILGEGIPVKLVPPFLYAA
LIALIYIWSNHKAESTIREIEDLQQEVEDLRADVTTLEAEYMFSSKQSEVARKIKVLNIY
EIEEPPKKIIRDK