Protein Info for Echvi_0302 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 39 to 416 (378 residues), 373.1 bits, see alignment E=7.7e-116 PF01546: Peptidase_M20" amino acids 96 to 423 (328 residues), 147 bits, see alignment E=7.5e-47 PF07687: M20_dimer" amino acids 224 to 320 (97 residues), 44.1 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 63% identity to dfe:Dfer_2714)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.47

Use Curated BLAST to search for 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUA4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Echvi_0302 amidohydrolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKPYLLLICIFFGGSVWGQSSLHRKIDDQATSIEPKVIEWRRDIHQNPELGNQETRTAK
LIASHLRSLGLEVEEKVAVTGVVGLLKGDHPGPTVALRADMDALPVTERNDLPFKSTKKT
VYNGQEIGIMHACGHDTHVAILMGVAEVLSSMKNDLHGTVKFIFQPAEEGVFEEGISSWG
AKQMVEEGVMDGVDAVFGLHINSQTEVGDIKYRSGPAMAAVDNLKLTVNGRQAHGAYPWS
SVDPIVTSSQMISALQTIISRNVNITENPAIVTIGSIHGGVRQNIIPEKVEMLGTVRTYG
TAQQELIHQRIHDIATHTAEAAGATVDVDIDKIYPATINDPGLTEKMVNTLKTVAGEEHV
IYHDPITGAEDFSYFQQQVPGLFIFLGGMPKGADPTKVAAHHTPDFFIDESGLLLGVRAL
SYLTVDYMAMDQ