Protein Info for Echvi_0298 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: gliding-associated putative ABC transporter substrate-binding component GldG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 539 to 562 (24 residues), see Phobius details TIGR03521: gliding-associated putative ABC transporter substrate-binding component GldG" amino acids 24 to 568 (545 residues), 589.1 bits, see alignment E=4.3e-181 PF23357: DUF7088" amino acids 45 to 154 (110 residues), 90.1 bits, see alignment E=9.8e-30 PF09822: ABC_transp_aux" amino acids 201 to 505 (305 residues), 301.1 bits, see alignment E=8.2e-94

Best Hits

KEGG orthology group: None (inferred from 40% identity to mtt:Ftrac_1430)

Predicted SEED Role

"gliding motility protein GldG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRP4 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Echvi_0298 gliding-associated putative ABC transporter substrate-binding component GldG (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQQSRDVRQKSRKWLLSGIAMLGLVLVTLFLLNKFTRFRIDLTEEQRFTLHASTKEILA
GLEEPLEVDILLSGKLPGGMRRFQQQIEATVETFNAYSGAPISVRYFDPMGIEDKQERDE
YIIYLAEFGINPTNLFATENGAQTSRLIFPGVIIRNATHETGGLLLNGNRGMSPDQILNL
SVENLEYELINMVRMLVQREKQAVAMITNHGELQGDQGYGIVEALSEDYEVYKVPLQKAK
GVEDLLSFAAIIVAGPRDAYSKREVYLLDQYLMRGGKLLLAIDPVAVDMEKAGGEGTVAV
GFDTGLDRMLFKYGVRINKDLIQDMNFGYYPVVAGEFGNQSQIVPLPWPFYVVANTMSSH
VIVKGFDQVMFRMVSSLDTVKATGVKKTPLIFSGQYSRKMPQPVRVAFEDMSQEPAISLF
NQKNLPLAYLLEGTFSSVFENRFLPEAFEVDPDFKEKSDGGALIVTGDGDWLQGEQDPTT
GDPLPLGTDPNTEANFANRELLQNMLRYLVNPDGIMATRSKELKIRPLDKKRVEQEKTFW
QVLNIALPVGLVLLIGLAKVYFRRRKYGRKG