Protein Info for Echvi_0263 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: ribosomal protein L7/L12
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to RL7_PARD8: 50S ribosomal protein L7/L12 (rplL) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 79% identity to psn:Pedsa_2265)Predicted SEED Role
"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FU73 at UniProt or InterPro
Protein Sequence (125 amino acids)
>Echvi_0263 ribosomal protein L7/L12 (Echinicola vietnamensis KMM 6221, DSM 17526) MADLKAFAEQLVNLTVKEVSELAEILKEEYGIEPAAAAAPVMVAGGAGEGAGEEEKSSFD VVLKAAGGQKLAVVKLVKELTGLGLKEAKEVVDGAPKAIKEGIAKDEAEALKKQLEEAGA EVELK