Protein Info for Echvi_0259 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: ribosomal protein S12, bacterial/organelle
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to RS12_CYTH3: 30S ribosomal protein S12 (rpsL) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 90% identity to mtt:Ftrac_3028)MetaCyc: 78% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FRL6 at UniProt or InterPro
Protein Sequence (126 amino acids)
>Echvi_0259 ribosomal protein S12, bacterial/organelle (Echinicola vietnamensis KMM 6221, DSM 17526) MPTIQQLVRKGRTTLVTKSKSRALDACPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNG KEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTAGVKDRKQGRSKYGAK RPKDKK