Protein Info for Echvi_0253 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Ribosomal protein L23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF00276: Ribosomal_L23" amino acids 2 to 91 (90 residues), 94.6 bits, see alignment E=1.9e-31

Best Hits

Swiss-Prot: 48% identical to RL23_HERA2: 50S ribosomal protein L23 (rplW) from Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)

KEGG orthology group: K02892, large subunit ribosomal protein L23 (inferred from 67% identity to chu:CHU_3160)

Predicted SEED Role

"LSU ribosomal protein L23p (L23Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU67 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Echvi_0253 Ribosomal protein L23 (Echinicola vietnamensis KMM 6221, DSM 17526)
MDILKKPLITEKISAMNERGVYGFVVEKTAKKPEIKAAVEKMFGVKVVSVRTMRYAGKLK
TRYTKTKVVSGYTNAFKKAIVQVADGEVIDFYGEI