Protein Info for Echvi_0231 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03631: ribosomal protein uS13
  • amino acids 3 to 115 (113 residues), 172.4 bits, E=1.8e-55
• PF00416: Ribosomal_S13
  • amino acids 3 to 109 (107 residues), 106.3 bits, E=7.8e-35

Best Hits

Swiss-Prot: 82% identical to RS13_CYTH3: 30S ribosomal protein S13 (rpsM) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 82% identity to chu:CHU_3139)

MetaCyc: 56% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See L0FUW2 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Echvi_0231 30S ribosomal protein S13 (Echinicola vietnamensis KMM 6221, DSM 17526)
MARIAGVDIPDNKRGEIGLTYIFGIGRSSAKAILTKAGISFDKKAGEWTDDESTAIRNII
AEEFKTEGVLKSEVQLNIKRLMDIGCYRGLRHRKGLPVRGQKTKNNARTRKGKRKTVANK
KKATK