Protein Info for Echvi_0225 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF03952: Enolase_N" amino acids 4 to 134 (131 residues), 207.2 bits, see alignment E=1.4e-65 TIGR01060: phosphopyruvate hydratase" amino acids 4 to 422 (419 residues), 683.1 bits, see alignment E=6.3e-210 PF00113: Enolase_C" amino acids 140 to 422 (283 residues), 424.5 bits, see alignment E=3.4e-131 PF13378: MR_MLE_C" amino acids 269 to 401 (133 residues), 32.9 bits, see alignment E=8.4e-12

Best Hits

Swiss-Prot: 75% identical to ENO_FLAJ1: Enolase (eno) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 76% identity to zpr:ZPR_3847)

MetaCyc: 68% identical to enolase subunit (Streptococcus mutans)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV49 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Echvi_0225 phosphopyruvate hydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTLITAIHARQILDSRGNPTVEVDVATESGAFGRAAVPSGASTGVNEAVELRDGDKSKYL
GKGVLEAVKNVNEIIQPELIGQSVFDQRGIDELMIQLDGTDTKSKLGANAILGVSLAVAK
AAADDLGLPLFRYVGGVNAKTLPVPMMNIINGGSHSDAPIAFQEFMIRPVGAPNFSEAMR
MGAEIFHNLKKILHDKGLSTAVGDEGGFAPNFSGGTEEALNCILDAISKAGYKPGDDVTI
ALDCAASEFFEDGKYNYKKFEGDTGVERNREEQVAYLAELTEKYPIDSIEDGCGEEDWEG
WAMLTAKIGDKVQLVGDDLFVTNVKFLQRGIEEKSANSILIKVNQIGTLTETLEAIDLAH
KAGFTAVMSHRSGETEDSTIADLAVACNTGQIKTGSASRSDRMSKYNQLLRIEELLGDTA
YFPKK