Protein Info for Echvi_0217 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hydroxyethylthiazole kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 186 to 206 (21 residues), see Phobius details amino acids 213 to 229 (17 residues), see Phobius details PF02110: HK" amino acids 9 to 252 (244 residues), 276.4 bits, see alignment E=2e-86 TIGR00694: hydroxyethylthiazole kinase" amino acids 9 to 254 (246 residues), 288.6 bits, see alignment E=2.2e-90 PF01256: Carb_kinase" amino acids 31 to 245 (215 residues), 40.9 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 55% identical to THIM_CHLT3: Hydroxyethylthiazole kinase (thiM) from Chloroherpeton thalassium (strain ATCC 35110 / GB-78)

KEGG orthology group: K00878, hydroxyethylthiazole kinase [EC: 2.7.1.50] (inferred from 62% identity to zpr:ZPR_1976)

MetaCyc: 42% identical to hydroxyethylthiazole kinase monomer (Bacillus subtilis subtilis 168)
Hydroxyethylthiazole kinase. [EC: 2.7.1.50]

Predicted SEED Role

"Hydroxyethylthiazole kinase (EC 2.7.1.50)" in subsystem Thiamin biosynthesis (EC 2.7.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU35 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Echvi_0217 hydroxyethylthiazole kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKESVINNLKTLREKGPLVQSITNYVVMNNTANALLAVGASPIMAHAKLEMADMVKIVHA
LVVNIGTLDEFWVDSMLLAAKEANERNTPWVLDPVGAGATPYRNETLTRLLTFKPTIIRG
NASEIMALAKANVQTKGVDSTHSSDEALAYGKQLSKETAAVVCISGETDYIIDGERLTKV
KNGHALMGKVTGMGCTATALIAAFAGITSDPYLATVAGMTTMGLAGEIAARKAEGPGTLQ
LYLYDALYHLKESEVKQWAKLEESHA